PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0167800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 287aa    MW: 31637.7 Da    PI: 8.2866
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0167800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.45.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed++l d+v+ +G g W+  +++ g++R++k+c++rw++yl
   Spipo0G0167800 14 RGAWSAQEDKILTDYVQTHGEGKWRDLPEKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.26.1e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++E++l ++++++lG++ W++Ia +++ gRt++++k++w++ 
   Spipo0G0167800  67 RGNISEDEEDLMIRLHRLLGNR-WSLIAGRLP-GRTDNEIKNHWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.223961IPR017930Myb domain
SuperFamilySSF466891.05E-2811108IPR009057Homeodomain-like
SMARTSM007176.2E-131363IPR001005SANT/Myb domain
PfamPF002493.5E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-231568IPR009057Homeodomain-like
CDDcd001676.07E-101661No hitNo description
PROSITE profilePS5129424.262116IPR017930Myb domain
SMARTSM007174.3E-1466114IPR001005SANT/Myb domain
PfamPF002494.1E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2269114IPR009057Homeodomain-like
CDDcd001671.71E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MGRKPCCSKV GLNRGAWSAQ EDKILTDYVQ THGEGKWRDL PEKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SEDEEDLMIR LHRLLGNRWS LIAGRLPGRT DNEIKNHWNT NLGKRASPSV  120
SPQPGAREIP MSLKKKTSAV GSTSPLAGSV HGVIRTKAVR CTRSLLSTPK KAPSMAPPAD  180
NDDGSLNFLG DLNVDEFMQS FREIDFPNDD YLSSAASSPL QQHFLIGGEV LEGCGRSSTL  240
PGSTMDASQA SKQEEGQLWG RCSDDHGFPV ELNPLFLPAS EDFYWN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391459.18e-85PREDICTED: transcription repressor MYB5-like
SwissprotQ9FJA22e-67TT2_ARATH; Transcription factor TT2
TrEMBLM0SCR18e-85M0SCR1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P07940_0012e-84(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-68MYB family protein